PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2BS_380EC4D1E.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 468aa    MW: 50688.1 Da    PI: 6.2328
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2BS_380EC4D1E.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY887.9e-28199254259
                            --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                            dDgynWrKYGqK vkg ++prsYY+Ct  +Cpv+k+ve+sa d+++++i+Y+g+H he
  Traes_2BS_380EC4D1E.1 199 DDGYNWRKYGQKAVKGGKYPRSYYKCTL-NCPVRKNVEHSA-DGRIIKIIYRGQHCHE 254
                            8*************************97.7***********.***************7 PP

2WRKY102.23e-32362420159
                            ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                            ldDgy+WrKYGqK+v+g+++prsYY+Ct++gC vkk++ers+e+p++v++tYeg+H+h+
  Traes_2BS_380EC4D1E.1 362 LDDGYRWRKYGQKVVRGNPHPRSYYKCTYQGCDVKKHIERSSEEPHAVITTYEGKHTHD 420
                            59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.6E-25195256IPR003657WRKY domain
SuperFamilySSF1182906.67E-22197256IPR003657WRKY domain
SMARTSM007747.7E-30198255IPR003657WRKY domain
PfamPF031064.6E-22199253IPR003657WRKY domain
PROSITE profilePS5081121.345199256IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.1E-34349422IPR003657WRKY domain
SuperFamilySSF1182906.28E-29355422IPR003657WRKY domain
PROSITE profilePS5081135.645357422IPR003657WRKY domain
SMARTSM007746.3E-38362421IPR003657WRKY domain
PfamPF031066.1E-25363420IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MAAGQWSGIG DGGGLWAPPA LDSLFPDDQP SPAASALGFF GGSLAQLPSP PPLCGTALLG  60
YPQDNFDVFH EQDLAQLAAQ VAQKKELREK QGAGLHHKIG PQLAFSKYSI LDQVDNSSSF  120
SLATSVLTPQ HVSSSVGAAS MQGQTLPSHT GSGSVNTGPT GVLQVLQDSS TTLDSINTGS  180
TGVLEALQGS SITLDRPADD GYNWRKYGQK AVKGGKYPRS YYKCTLNCPV RKNVEHSADG  240
RIIKIIYRGQ HCHEPPSKRF KDCGDLLNEL NDFNDAKEPS TKSQLGCQGY YGKPITPNGM  300
MTDVLLPTKE EGDEQLSSLS DIREGDGEIR TVDGDDGDAD ANERNAPGQK IIVSTTSDVD  360
LLDDGYRWRK YGQKVVRGNP HPRSYYKCTY QGCDVKKHIE RSSEEPHAVI TTYEGKHTHD  420
VPESRNRSQA TGQHHCKEQT YSEQSAASFC SSSEKRKYGT AILNDLAF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-33199422878Probable WRKY transcription factor 4
2lex_A1e-33199422878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU6654300.0EU665430.1 Triticum aestivum WRKY19 transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003562765.10.0PREDICTED: probable WRKY transcription factor 3 isoform X1
SwissprotQ9ZQ707e-69WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLW5BJD90.0W5BJD9_WHEAT; Uncharacterized protein
STRINGMLOC_5850.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP134538122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.11e-69WRKY DNA-binding protein 3
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]